Abstract
Footnotes
,†,Human T-cell leukemia/lymphoma virus type 1 (HTLV-1) is the causative agent of adult T-cell leukaemia/lymphoma (ATLL) (Yoshida et al., 1984) and of tropical spastic paraparesis/HTLV-1-associated myelopathy (TSP/HAM) (Gessain et al., 1985). It has also been associated with a number of inflammatory diseases (Ijichi et al., 1990; Lagrenade et al., 1990; Mochizuki et al., 1992; Morgan et al., 1989). The overall prevalence of severe HTLV-1-associated disease is 28 % among HTLV-1-infected persons, estimated to comprise 1525 million people worldwide, mostly in Central and South America, Equatorial Africa and Asia (de Thé & Kazanji, 1996). With the exception of a few cases surviving after bone-marrow transplantation, no treatment has been shown to prevent eventual relapse of aggressive ATLL effectively. Thus, the development of an HTLV-1 vaccine is crucial.
The genomic stability of HTLV-1 and the presence of neutralizing antibodies in HTLV-1-infected individuals are favourable factors for the design of an efficient HTLV-1 vaccine. A major obstacle to the development of an HTLV-1 vaccine, however, has been the lack of an appropriate animal model. Many models of HTLV-1 infection, including rabbits (Cockerell et al., 1990; Lairmore et al., 1992; Miyoshi et al., 1985), rats (Ibrahim et al., 1994; Ishiguro et al., 1992; Kazanji et al., 1997b; Yoshiki et al., 1987) and monkeys (Ibuki et al., 1997; Kazanji, 2000; Nakamura et al., 1986), have been used to test vaccine candidates and to study pathogenesis and virushost interactions. Over the past few years, we have shown that the squirrel monkey, Saimiri sciureus, is susceptible to experimental infection with HTLV-1-immortalized cells. As in humans, experimental inoculation leads to chronic infection (Kazanji et al., 1997c). The adequacy of the model is supported further by specificity for the target cell, the CD4 T helper lymphocyte, and by a replication strategy that is similar to that of HTLV-1 in humans (Mortreux et al., 2001). As in humans, HTLV-1 infection of squirrel monkeys, after an extended latency, leads to continuous expansion of a restricted number of abundant HTLV-1 cellular clones (Mortreux et al., 2001). We showed recently that some chronically infected monkeys had high CD4+ T-cell counts concomitant with an increased total lymphocyte population; a significant proportion of these lymphocytes were infected and flower cells were found in peripheral blood (Debacq et al., 2005). The squirrel monkey thus appears to be a suitable model for studying the pathogenesis of HTLV-1 and for evaluating candidate vaccines (Kazanji, 2000; Kazanji et al., 2001).
Peptide-based vaccines have been used as candidates for HTLV-1 vaccines. Frangione-Beebe et al. (2000) showed that a peptide construct comprising aa 175218 (FLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTL) of gp46 linked by a four-residue turn (GPSL) to a promiscuous T-cell epitope from the measles virus fusion protein (MVF) aa 288306 (KLLSLIKGVIVHRLEGVE) with the adjuvant N-acetylglucosamine-3yl-acetyl-L-alanyl-D-isoglutamine was immunogenic in outbred populations of rabbits and mice. Sundaram et al. (2003) designed a novel multivalent peptide construct comprising three HLA-A*0201-restricted CTL epitopes located on aa 1119 (LLFGYPVYV), 178186 (QLGAFLTNV) and 306315 (HLLFEEYTNI) of the HTLV-1 Tax protein, with double arginine residues intervening in tandem (Tri-Tax). These peptides were selected because of their ability to induce secretion of gamma interferon (IFN-γ) in peripheral blood mononuclear cells (PBMCs) obtained from HLA-A2-infected persons. Immunization of HLA-A*0201 transgenic mice with this construct elicited cellular responses to each intended epitope and protected the mice against challenge with recombinant vaccinia virus containing the tax gene (Sundaram et al., 2004a).
In the study reported here, we evaluated the immunogenicity and protective efficacy in squirrel monkeys of a B-cell epitope peptide located on aa 175218 of the env gene and of a new, selected T-cell multiepitope derived from Tri-Tax, both conjugated to promiscuous T-cell epitopes as described above.
To evaluate the frequency of circulating effector T cells against the three selected Tax peptides (located at aa 1119, 178186 and 306315 of the Tax protein) in HTLV-1-infected monkeys, we used enzyme-linked immunospot (ELISPOT) assays, performed as described by Sundaram et al. (2003), with anti-IFN-γ monoclonal antibody 1-D1K (Mabtech) as the coating antibody and biotinylated anti-IFN-γ monoclonal antibody 7-B6-1 (Mabtech) as the secondary antibody, as described in the manufacturer's instructions. These anti-human IFN-γ antibodies recognized squirrel monkey IFN-γ (data not shown). PBMCs (2x105) were added to anti-IFN-γ-coated ELISPOT 96-well plates and stimulated in triplicate wells with 10 µmol each peptide or irrelevant peptide ml1 for 40 h. IFN-γ-secreting cells were counted with an ELISPOT image analyser. PBMCs from two monkeys chronically infected with HTLV-1 (nos 1715 and 1491) were used in the assay. In monkey 1715, only two of the three tested peptides, aa 1119 and 178186, induced a high level of IFN-γ, with 222±15 and 158±8·8 spots (106 cells)1, respectively (irrelevant peptide induced 15±3·5 spots). In the second infected animal, monkey 1491, all three peptides induced IFN-γ, with 259±62 spots for the 1119 peptide, 113±5·5 for the 178186 peptide and 297±42 for the 306315 peptide. The irrelevant peptide induced 33±1·7 spots (106 cells)1. These results indicated the presence of virus-specific circulating effector cells in HTLV-1-infected monkeys that can produce IFN-γ in the presence of the selected Tax epitopes.
To evaluate the immunogenicity and protective efficacy of these Tax peptides and of a selected B-cell epitope, we used four 6-year-old male squirrel monkeys. Two monkeys (A047C and A064C) were injected intramuscularly twice, at 0 and 4 weeks, with the Env B-cell epitope aa 175218 (500 µg per monkey) linked to the promiscuous T-helper cell epitope MVF (700 µg per monkey), as described previously (Frangione-Beebe et al., 2000). Six weeks after the first immunization, the monkeys were injected with another construct, consisting of the three Tax CTL epitopes (aa 1119, 178186, 306315), as described previously (Sundaram et al., 2003, 2004a). Monkeys were boosted twice at weeks 9 and 16 with both B- and T-cell epitopes (Fig. 1). Two control animals (A078C and A103C) were injected with irrelevant B- and T-cell peptides. We determined the antibody response every 23 weeks throughout the study by direct ELISA, as described previously (Frangione-Beebe et al., 2000).
|
As seen in Fig. 1(a), antibodies against both the B-cell epitope peptide and the immunogen MVF175218 were detected in the two immunized monkeys after the first boost and the response increased further with successive boosts. The antibody titre to the immunogen was higher than that to the B-cell epitope. Furthermore, the Env chimeric peptide was highly immunogenic in monkey A047C, eliciting a higher antibody response than in monkey A064C. No antibody response was detected in the two control monkeys (data not shown).
For peptide antibodies to be effective in neutralizing viral infection, they must cross-react with the native protein from which the epitope is derived. Binding of the peptide antibodies to HTLV-1-infected (MT-2) cells was tested by flow cytometry, as described previously (Sundaram et al., 2004b). As seen in Fig. 1(b), the antisera from both immunized monkeys bound to the surface of the MT-2 cells, indicating that the antibodies recognized the native protein. Pre-immune serum from the same monkeys and sera from the control monkeys (A078C and A103C), used as negative controls, showed no binding, as expected (Fig. 1b).
To evaluate the cellular immune response against Env (aa 175218) and Tax peptides, the ELISPOT assay was performed 1 week after the last boost in the immunized monkeys and controls. In the control monkey A103C, the number of IFN-γ-producing cells in the presence of 175218 peptide was equivalent to that observed in the presence of irrelevant peptide or media alone (Fig. 2). Similar results were also obtained in a second control animal, A078C (data not shown). In contrast, PBMCs from the two immunized monkeys showed a three- to sevenfold increase in IFN-γ-producing cells, indicting a robust immune response to the selected antigen (aa 175218). Depletion of CD4+ lymphocytes reduced the number of IFN-γ-producing cells from immunized monkeys to a level similar to that of the control animals (Fig. 2).
|
The cellular immune response was also evaluated against the Tax peptides. As shown in Fig. 2, a high frequency of IFN-γ-producing cells was detected in the presence of the immunogen construct (Tri-Tax peptide) in the two immunized animals but not in the control. When PBMCs were stimulated with the three selected peptides (aa 1119, 178186 and 306315) individually, however, no difference was found between the immunized and control animals (Fig. 2). Interestingly, in the case of the anti-Tax response, depletion of CD4+ lymphocytes only slightly reduced IFN-γ production (Fig. 2).
The immunized monkeys were challenged 15 days after the last boost with an intravenous injection of 5x107 cells of a squirrel monkey HTLV-1-transformed cell line (EVO/1540), as described previously (Kazanji et al., 1997c). Another control monkey (A119C), which was free of HTLV-1 and was not immunized, was also included in the study. The serum levels of specific HTLV-1 antibodies were determined by ELISA (Cobas Core Anti-HTLV-I/II EIA; Roche) and confirmed by Western blot analysis (HTLV-1 blot 2.3; Diagnostic Biotechnology). Five months after challenge, the two immunized monkeys (A047C and A064C) had not undergone seroconversion against HTLV-1, while the two controls animals (A078C and A103C) immunized with irrelevant peptide and the new control monkey (A119C) developed an HTLV-1 antibody response (Fig. 3a). Western blot analysis performed at 5 months after challenge showed that one of the two immunized animals (A047C) had not undergone seroconversion against HTLV-1 antigens (Fig. 3b, lane 3), while the second animal (A064C) showed only a low response against the recombinant gp-21 protein (Fig. 3b, lane 4). Seroconversion against HTLV-1 Env and Gag proteins was found in the three control animals, similar to that observed in one animal chronically infected with HTLV-1 (Fig. 3b, lanes 58).
|
Six months after challenge, the five challenged monkeys were killed and the HTLV-1 proviral load was evaluated in PBMCs and spleen by quantitative PCR. The proviral load was measured with an ABI PRISM 7700 Sequence Detector (Perkin Elmer/Applied Biosystems), as described elsewhere (Kubota et al., 2000). No HTLV-1 provirus copy could be detected in the PBMCs or the spleen of immunized monkey A047C. In the second animal (A064C), 20 HTLV-1 copies were found in 1 µg DNA from PBMCs and 40 copies in spleen. These values were much lower than the copy numbers detected in the two control animals, A078C (370 copies in PBMCs and 150 in spleen) and A103C (1110 copies in PBMCs and 220 in spleen), immunized with irrelevant peptide or in the unimmunized monkey A119C (2420 copies in PBMCs and 400 in spleen).
In this study, we have shown that immunization of squirrel monkeys with a peptide construct containing B- and T-cell epitopes can elicit a high titre of antibodies, a high frequency of specific IFN-γ-producing cells and partial protection.
We showed first that PBMCs from chronically HTLV-1-infected monkeys could produce IFN-γ in the presence of the Tri-Tax peptide. We showed previously that HTLV-1-infected squirrel monkeys develop a cell-mediated immune response against target cells infected with recombinant vaccinia expressing the whole p40 Tax protein (Kazanji et al., 2000). In the present study, we confirmed our previous data by demonstrating a high frequency of IFN-γ-producing cells in two HTLV-1-infected monkeys.
The CTL response in our squirrel monkey model appears to be comparable to that observed in asymptomatic human HTLV-1 carriers. In carriers and patients with TSP/HAM, the CTL response is also directed mainly against the p40 Tax protein (Jacobson, 2002). It has been shown recently that the HTLV-1 proviral load is a strong predictor of disease progression and that patients with TSP/HAM or ATLL have a higher proviral load than asymptomatic HTLV-1 carriers (Jacobson, 2002; Yamano et al., 2002). It has been suggested that this cellular response plays a major role in controlling HTLV-1 replication and then maintaining a low viral load (Bangham, 2003; Bangham et al., 1996; Jacobson, 2002). In our study, the immunized monkeys developed a strong cellular immune response, as detected by IFN-γ-producing cells, in the presence of selected peptides. Furthermore, a significant reduction in the proviral load was seen in these immunized monkeys after challenge. These results provide a rational background for clinical use of such a vaccine, not only for controlling infection, but also for preventing associated diseases. However, further efforts should be directed towards elucidating the duration of this protection.
Administration of the peptides with adjuvant induced both a high antibody response and a cellular immune response, and the antibody response against Env peptide was increased in immunized animals after boosting. Furthermore, these antibodies recognized the native protein in MT-2 cells. The Env protein has been reported to confer partial protection against HTLV-1 infection in various animal models, but the mechanisms of immunity associated with the protection remain unclear (Franchini et al., 1995; Kazanji et al., 1997a). In our study, a cell-mediated immune response was also detected, which was strong in the presence of the 175218 B-cell epitope; however, depletion of CD4+ lymphocytes reduced the number of IFN-γ-producing cells from immunized monkeys to a level similar to that in controls. Therefore, the CD4+ subset of lymphocytes, which give the T-cell help required for high antibody titres, contributes to the vaccine-induced cellular immune response (Goon et al., 2002). In contrast, the reduction in the number of cells producing IFN-γ in response to the Tri-Tax T-cell epitope peptide was much lower than with the B-cell epitope peptide, indicating the involvement of other virus-specific T-cell subsets in this cellular immune response.
Although we found a potent response to the peptide containing the three Tax epitopes, individual Tax peptides did not induce IFN-γ production. This absence of response might indicate that epitope(s) distinct from those recognized by humans are recognized by responder monkeys because of differences in major histocompatibility complex class I molecules. In order to characterize further the immune response involved in HTLV-1 infection and in response to administration of this vaccine in squirrel monkeys, we intend to investigate the genetic structure and polymorphism of this gene in our colony of squirrel monkeys.
The monkey that showed the highest antibody titre and the highest level of specific IFN-γ-producing cells was totally protected after challenge. As we could not demonstrate a specific cellular immune response against an individual Tax peptide, we cannot draw any conclusions on the effective role of this combined vaccination in the induction of this complete protection. However, we reported previously that monkeys primed with naked DNA containing the HTLV-1 env gene and then boosted with the vaccinia virus vector NYVAC containing the env and gag genes developed both humoral and cell-mediated immune responses to Env and Gag after boosting. Furthermore, protection against challenge was observed in monkeys receiving the vaccine for both Env and Gag, but not in monkeys immunized with Env alone (Kazanji et al., 2001). Thus, Gag components are also important in HTLV-1 vaccine design. Further studies including the use of different immunogens and a larger number of animals should be directed towards elucidating complete and long-term protection against HTLV-1 infection.
References
Bangham, C. R. M., Kermode, A. G., Hall, S. E. & Daenke, S. (1996). The cytotoxic T-lymphocyte response to HTLV-I: the main determinant of disease? Semin Virol 7, 4148.
Cockerell, G. L., Lairmore, M., De, B., Rovnak, J., Hartley, T. M. & Miyoshi, I. (1990). Persistent infection of rabbits with HTLV-I: patterns of anti-viral antibody reactivity and detection of virus by gene amplification. Int J Cancer 45, 127130.[Medline]
Debacq, C., Héraud, J.-M., Asquith, B. & 9 other authors (2005). Reduced cell turnover in lymphocytic monkeys infected by human T-lymphotropic virus type 1. Oncogene 24, 75147523.[CrossRef][Medline]
de Thé, G. & Kazanji, M. (1996). An HTLV-I/II vaccine: from animal models to clinical trials? J Acquir Immune Defic Syndr Hum Retrovirol 13, S191S198.[Medline]
Franchini, G., Tartaglia, J., Markham, P. & 7 other authors (1995). Highly attenuated HTLV type I env poxvirus vaccines induce protection against a cell-associated HTLV type I challenge in rabbits. AIDS Res Hum Retroviruses 11, 307313.[Medline]
Frangione-Beebe, M., Albrecht, B., Dakappagari, N., Rose, R. T., Brooks, C. L., Schwendeman, S. P., Lairmore, M. D. & Kaumaya, P. T. P. (2000). Enhanced immunogenicity of a conformational epitope of human T-lymphotropic virus type 1 using a novel chimeric peptide. Vaccine 19, 10681081.[CrossRef][Medline]
Gessain, A., Barin, F., Vernant, J. C., Gout, O., Maurs, L., Calender, A. & de Thé, G. (1985). Antibodies to human T-lymphotropic virus type-I in patients with tropical spastic paraparesis. Lancet ii, 407410.
Goon, P. K. C., Hanon, E., Igakura, T., Tanaka, Y., Weber, J. N., Taylor, G. P. & Bangham, C. R. M. (2002). High frequencies of Th1-type CD4+ T cells specific to HTLV-1 Env and Tax proteins in patients with HTLV-1-associated myelopathy/tropical spastic paraparesis. Blood 99, 33353341.
Ibrahim, F., Fiette, L., Gessain, A., Buisson, N., de Thé, G. & Bomford, R. (1994). Infection of rats with human T-cell leukemia virus type-I: susceptibility of inbred strains, antibody response and provirus location. Int J Cancer 58, 446451.[Medline]
Ibuki, K., Funahashi, S. I., Yamamoto, H., Nakamura, M., Igarashi, T., Miura, T., Ido, E., Hayami, M. & Shida, H. (1997). Long-term persistence of protective immunity in cynomolgus monkeys immunized with a recombinant vaccinia virus expressing the human T cell leukaemia virus type I envelope gene. J Gen Virol 78, 147152.[Abstract]
Ijichi, S., Matsuda, T., Maruyama, I. & 7 other authors (1990). Arthritis in a human T-lymphotropic virus type I (HTLV-I) carrier. Ann Rheum Dis 49, 718721.
Ishiguro, N., Abe, M., Seto, K., Sakurai, H., Ikeda, H., Wakisaka, A., Togashi, T., Tateno, M. & Yoshiki, T. (1992). A rat model of human T lymphocyte virus type I (HTLV-I) infection. 1. Humoral antibody response, provirus integration, and HTLV-I-associated myelopathy/tropical spastic paraparesis-like myelopathy in seronegative HTLV-I carrier rats. J Exp Med 176, 981989.
Jacobson, S. (2002). Immunopathogenesis of human T cell lymphotropic virus type I-associated neurologic disease. J Infect Dis 186, S187S192.[Medline]
Kazanji, M. (2000). HTLV type 1 infection in squirrel monkeys (Saimiri sciureus): a promising animal model for HTLV type 1 human infection. AIDS Res Hum Retroviruses 16, 17411746.[Medline]
Kazanji, M., Bomford, R., Bessereau, J.-L., Schulz, T. & de Thé, G. (1997a). Expression and immunogenicity in rats of recombinant adenovirus 5 DNA plasmids and vaccinia virus containing the HTLV-I-env gene. Int J Cancer 71, 300307.[CrossRef][Medline]
Kazanji, M., Ibrahim, F., Fiette, L., Bomford, R. & de Thé, G. (1997b). Role of the genetic background of rats in infection by HTLV-I and HTLV-II and in the development of associated diseases. Int J Cancer 73, 131136.[CrossRef][Medline]
Kazanji, M., Moreau, J.-P., Mahieux, R., Bonnemains, B., Bomford, R., Gessain, A. & de Thé, G. (1997c). HTLV-I infection in squirrel monkey (Saïmiri sciureus) using autologous, homologous or heterologous HTLV-I-transformed cell lines. Virology 231, 258266.[CrossRef][Medline]
Kazanji, M., Ureta-Vidal, A., Ozden, S., Tangy, F., de Thoisy, B., Fiette, L., Talarmin, A., Gessain, A. & de Thé, G. (2000). Lymphoid organs as a major reservoir for human T-cell leukemia virus type 1 in experimentally infected squirrel monkeys (Saimiri sciureus): provirus expression, persistence, and humoral and cellular immune responses. J Virol 74, 48604867.
Kazanji, M., Tartaglia, J., Franchini, G., de Thoisy, B., Talarmin, A., Contamin, H., Gessain, A. & de Thé, G. (2001). Immunogenicity and protective efficacy of recombinant human T-cell leukemia/lymphoma virus type 1 NYVAC and naked DNA vaccine candidates in squirrel monkeys (Saimiri sciureus). J Virol 75, 59395948.
Kubota, R., Kawanishi, T., Matsubara, H., Manns, A. & Jacobson, S. (2000). HTLV-I specific IFN-γ+ CD8+ lymphocytes correlate with the proviral load in peripheral blood of infected individuals. J Neuroimmunol 102, 208215.[CrossRef][Medline]
LaGrenade, L., Hanchard, B., Fletcher, V., Cranston, B. & Blattner, W. (1990). Infective dermatitis of Jamaican children: a marker for HTLV-I infection. Lancet 336, 13451347.[CrossRef][Medline]
Lairmore, M. D., Roberts, B., Frank, D., Rovnak, J., Weiser, M. G. & Cockerell, G. L. (1992). Comparative biological responses of rabbits infected with human T-lymphotropic virus type I isolates from patients with lymphoproliferative and neurodegenerative disease. Int J Cancer 50, 124130.[Medline]
Miyoshi, I., Yoshimoto, S., Kubonishi, I. & 8 other authors (1985). Infectious transmission of human T-cell leukemia virus to rabbits. Int J Cancer 35, 8185.[Medline]
Mochizuki, M., Yamaguchi, K., Takatsuki, K., Watanabe, T., Mori, S. & Tajima, K. (1992). HTLV-I and uveitis. Lancet 339, 1110.[Medline]
Morgan, O., Rodgers-Johnson, P., Mora, C. & Char, G. (1989). HTLV-I and polymyositis in Jamaica. Lancet ii, 11841186.
Mortreux, F., Kazanji, M., Gabet, A. S., de Thoisy, B. & Wattel, E. (2001). Two-step nature of human T-cell leukemia virus type 1 replication in experimentally infected squirrel monkeys (Saimiri sciureus). J Virol 75, 10831089.
Nakamura, H., Tanaka, Y., Komuro-Tsujimoto, A., Ishikawa, K., Takadaya, K., Tozawa, H., Tsujimoto, H., Honjo, S. & Hayami, M. (1986). Experimental inoculation of monkeys with autologous lymphoid cell lines immortalized by and producing human T-cell leukemia virus type-I. Int J Cancer 38, 867875.[Medline]
Sundaram, R., Sun, Y., Walker, C. M., Lemonnier, F. A., Jacobson, S. & Kaumaya, P. T. (2003). A novel multivalent human CTL peptide construct elicits robust cellular immune responses in HLA-A*0201 transgenic mice: implications for HTLV-1 vaccine design. Vaccine 21, 27672781.[CrossRef][Medline]
Sundaram, R., Lynch, M. P., Rawale, S., Dakappagari, N., Young, D., Walker, C. M., Lemonnier, F., Jacobson, S. & Kaumaya, P. T. (2004a). Protective efficacy of multiepitope human leukocyte antigen-A*0201 restricted cytotoxic T-lymphocyte peptide construct against challenge with human T-cell lymphotropic virus type 1 Tax recombinant vaccinia virus. J Acquir Immune Defic Syndr 37, 13291339.[Medline]
Sundaram, R., Lynch, M. P., Rawale, S. V., Sun, Y., Kazanji, M. & Kaumaya, P. T. (2004b). De novo design of peptide immunogens that mimic the coiled coil region of human T-cell leukemia virus type-1 glycoprotein 21 transmembrane subunit for induction of native protein reactive neutralizing antibodies. J Biol Chem 279, 2414124151.
Yamano, Y., Nagai, M., Brennan, M. & 7 other authors (2002). Correlation of human T-cell lymphotropic virus type 1 (HTLV-1) mRNA with proviral DNA load, virus-specific CD8+ T cells, and disease severity in HTLV-1-associated myelopathy (HAM/TSP). Blood 99, 8894.
Yoshida, M., Seiki, M., Yamaguchi, K. & Takatsuki, K. (1984). Monoclonal integration of human T-cell leukemia provirus in all primary tumors of adult T-cell leukemia suggests causative role of human T-cell leukemia virus in the disease. Proc Natl Acad Sci U S A 81, 25342537.
Yoshiki, T., Kondo, N., Chubachi, T., Tateno, M., Togashi, T. & Itoh, T. (1987). Rat lymphoid cell lines with HTLV-I production. III. Transmission of HTLV-I into rats and analysis of cell surface antigens associated with HTLV-I. Arch Virol 97, 181196.[Medline]
Received 3 October 2005; accepted 31 December 2005.
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| INT J SYST EVOL MICROBIOL | MICROBIOLOGY | J GEN VIROL |
| J MED MICROBIOL | ALL SGM JOURNALS | |