Research Article

An enterovirus strain isolated from diabetic child belongs to a genetic subcluster of echovirus 11, but is also neutralised with monotypic antisera to coxsackievirus A9

Journal of General Virology 2008; 89(8):1949 · https://doi.org/10.1099/vir.0.83474-0

View at publisher PubMed

With thanks to our partners for supporting this archive.

Abstract

An enterovirus strain (designated D207) isolated from a Slovakian diabetic child and originally serotyped as coxsackievirus A9 (CAV-9) was found to cause rapid cytolysis coinciding with severe functional damage of the surviving cells in primary cultures of human pancreatic islets. This finding prompted us to clone the isolate for full-length genome sequencing and molecular characterization as the prototype strain of CAV-9 is known to cause only minimal damage to insulin-producing β-cells. Based on capsid-coding sequence comparisons, the isolate turned out to be echovirus 11 (E-11). Phylogenetic analyses demonstrated that E-11/D207 was closely related to a specific subgroup B of E-11 strains known to cause uveitis. To study further antigenic properties of isolate E-11/D207 and uveitis-causing E-11 strains, neutralization experiments were carried out with CAV-9- and E-11-specific antisera. Unlike the prototype strains, the isolate E-11/D207 and uveitis-causing E-11 strains were well neutralized with both CAV-9- and E-11-specific antisera. Attempts to identify recombination of the capsid coding sequences as a reason for double-reactivity using the Simplot analysis failed to reveal major transferred motifs. However, peptide scanning technique was able to identify antigenic regions of capsid proteins of E-11/D207 as well as regions cross-reacting with an antiserum raised to CAV-9. Thus, double specificity of E-11/D207 seems to be a real characteristic shared by the phylogenetically closely related virus strains in the genetic subgroup B of E-11.

The GenBank/EMBL/DDBJ sequence accession number for the sequence reported in this paper is EF634316.

Supplementary Tables are available with the online version of this paper.

Enteroviruses (EV) belonging to the family Picornaviridae are the most common of human viruses, infecting an estimated billion people annually worldwide. Human enteroviruses (HEV) are subdivided into four species (HEV-A–HEV-D) on the basis of phylogenetic properties (). Almost 100 different EV serotypes are already recognized, but the number is increasing as the new phylogenetic type identification (Oberste et al., 1999) is revealing new types among the previously non-typable strains.

EV exhibit a wide range of acute clinical manifestations including meningitis, encephalitis and paralysis, but also those of milder symptoms like common cold, eye infections, acute otitis media and skin disease. Infections of this virus group are also known to cause acute and chronic myocarditis in humans. More recently, infections caused by EV have been associated to atherosclerotic disease, myocardial infarction (Reunanen et al., 2002, 2005; Roivainen et al., 1998a, 1999), type 1 diabetes (T1D; Andreoletti et al., 1997; Clements et al., 1995; Hyoty et al., 1995; Roivainen et al., 1998b) and also to bronchiolitis and asthma (Jartti et al., 2004).

The EV serotypes associated with pathogenesis of T1D have been assessed by cross-sectional and prospective studies on patients with T1D and/or prediabetic individuals. For the time being, there is no evidence suggesting that only certain EV serotypes should be considered potentially diabetogenic and it is also possible that viral features other than phenotypic properties of the capsid would have a key role in the process. Attempts have been made to identify viral determinants responsible for diabetogenic properties through full-genome sequencing of selected virus strains, but the critical determinants remain to be discovered (Al-Hello et al., 2005; Kang et al., 1994; Paananen et al., 2003; Titchener et al., 1994; Williams et al., 2006).

Traditionally, identification of EV infections has been based on virus isolation in cell culture followed by neutralization typing by monotypic antiserum pools. The method is highly specific. Although polyclonal antiserum contains antibodies to several different epitopes, and some of them might be cross-reactive in binding assays among related virus serotypes, they do not confuse the results of neutralization. In the assay only virus strains belonging to the serotype used as an immunogen in the antibody production could be neutralized. Therefore, the dual neutralization of the virus is usually considered as a technical error. More recently, molecular methods for identification of the serotype of an EV isolate have been developed (Oberste et al., 1999) which have changed the laboratory diagnosis of EV infections considerably.

In this study, a virus strain isolated from a diabetic child and originally serotyped as CAV-9 was studied for β-cell tropism and cloned for molecular characterization. However, based on whole-genome sequence, the isolate turned out to be echovirus 11 (E-11). Phylogenetic analyses demonstrated that this strain was closely related to a specific subgroup of E-11 strains known to cause uveitis. Neutralization studies with CAV-9- and E-11-specific antisera demonstrated that these genetically related virus strains were exceptional, since they were neutralized by both CAV-9- and E-11-specific antisera. Antigenic regions of the isolate as well as viral epitopes responsible for cross-reactivity with CAV-9 were identified by peptide scanning technique.

Cells and viruses.
GMK, a continuous cell line of green monkey kidney origin, was used for virus propagation. The cell line was maintained in Eagle's Minimal Essential medium (MEM) supplemented with 10 % fetal calf serum (FCS) and screened regularly for bacterial, fungal and mycoplasma contamination. Prototype strains of CAV-9/Griggs and E-11/Gregory were obtained from ATCC. Crude virus preparations grown in GMK cells in MEM supplemented with 1 % FCS, 20 mM MgCl2 and penicillin and streptomycin were clarified by low-speed centrifugation and used for plaque neutralization and molecular characterization.

Strains E-11/Kust/86, E-11/Kar/87 and E11/Kh3/97 were provided by A.N. Lukashev (Lukashev et al., 2002, 2003). The first two strains were causative agents of uveitis outbreaks in Siberia in 1986 and 1987, while the third virus was an occasional isolate in the Russian Far East in 1997.

Antiserum pools and monotypic sera.
EV-specific neutralizing antiserum pools and monotypic polyclonal rabbit antisera, which were used originally for isolate typing, were obtained as a gift from the Russian Academy of Medical Sciences, Moscow.

Plaque neutralization assay.
Pretitrated virus (approx. 100 p.f.u.) was incubated (1 h at 36 °C, then overnight at room temperature) with equal volume of virus-specific polyclonal antiserum from hyperimmunized rabbits. The preneutralized virus samples were quantified for infectious live virus by administration onto GMK cell monolayers (six-well plates). The plates were incubated for 30 min at 36 °C in the presence of 5 % CO2 and overlaid by 2 ml of 0.5 % carboxy methyl cellulose in culture medium. The amount of plaques was counted after 2 days incubation at 36 °C in the presence of 5 % CO2.

Purification of RNA.
Total RNA was extracted from cells infected with E-11 D207 using TRIzol Reagent (Gibco-BRL) according to the manufacturer's instructions.

cDNA synthesis.
cDNA was synthesized from purified RNA using a SuperScript First-Strand Synthesis System for RT-PCR kit (Invitrogen) according to the manufacturer's instructions. The reverse primer A83A (5'-CCGCGGCCGCTTTTTTTTTTTTTTTTTTTTTTTTCCTCCGCACCGAATGCGGAGAATTTACCCCTACTGC-3') was used in the reaction.

Synthesis of full-length PCR product.
The full-length PCR product was synthesized using a SuperScript One-Step RT-PCR for Long Templates kit (Invitrogen) according to the manufacturer's instructions. The sample was already cDNA so the cDNA synthesis step was omitted. The primers used were forward primer A82S (5'-GAGATCGATTAATACGACTCACTATAGGTTTAAAACAGCCTGTGGGTTGTTCCCACCC-3') and reverse primer A83A (see above).

Ligation and transformation.
Purified PCR product was ligated using pGEM-T Easy Vector System I kit (Promega) according to the manufacturer's instructions without a prior A-tailing step. The ligation reaction took place at 4 °C overnight. The ligated products were transformed into competent Escherichia coli DH5α cells.

Purification of plasmid DNA.
Plasmid DNA was isolated using QIAprep Spin Miniprep kit protocol (Qiagen). The dried pellet was then eluted. In order to select clones for further experiments, a small amount of the purified plasmid DNA was analysed for the presence of full-length inserts.

Transcription of RNA and transfection.
Clones, containing full-length inserts, were digested with the NotI restriction enzyme (New England Biolabs) and then transcribed into RNA using T7 polymerase (Roche) for 1 h at 37 °C. Transcribed RNA (5 and 20 µl) was transfected into sub-confluent GMK cells to determine their infectivity using Lipofectamine and Plus reagent (Invitrogen).

Sequencing.
The full-length infectious clone was sequenced using the primer walking strategy. Every nucleotide was sequenced at least twice. The cycle sequencing reactions were performed using a BigDye Terminator v1.1 Cycle Sequencing kit (Applied Biosystems). Automated sequencing equipment ABI Prism 310 Genetic Analyzer (Applied Biosystems) was used. Primers (Table S1) were purchased from DNA Technology A/S. The pUC/M13 Forward primer was purchased from Promega. Sequence data were analysed using Vector NTI Suite 6, assembled using ContigExpress and aligned using AlignX software.

Phylogenetic analysis.
The nucleotide and amino acid sequences were aligned by CLUSTAL_X 1.83 (Thompson et al., 1997). Phylogenetic trees were produced by Bootstrap N-J Tree (CLUSTAL_X 1.83) using 1000 bootstrap replicates (bootstrap value 700 was considered significant) and were visualized with NJPlot (Perriere & Gouy, 1996). Similarity analysis of complete genomes was performed with SimPlot 2.5 (Lole et al., 1999) with a window of 200 nucleotides.

The following previously published complete EV sequences used in phylogenetic trees were obtained from GenBank: coxsackievirus A9 Griggs (CAV-9) (D00627[GenBank] ), B1 coxsackievirus Japan (M16560[GenBank] ), (CBV-1) Ohio (AF085363[GenBank] ), CBV-3 Nancy (M33854[GenBank] ), CBV-4 J.V.B. (X05690[GenBank] ), CBV-5 Faulkner (AF114383[GenBank] ), CBV-6 Schmitt (AF114384[GenBank] ), echovirus 1 (E-1) Farouk (AF029859[GenBank] ), E-2 Cornelis (AY302545[GenBank] ), E-3 Morrisey (AY302553[GenBank] ), E-3 PicoBank/DM1/E3 (AJ849942[GenBank] ), E-4 Pesacek (AY302557[GenBank] ), E-5 Noyce (AF083069[GenBank] ), E-6 D'Amori (AY302558[GenBank] ), E-7 Wallace (AY036579[GenBank] ), E-9 Barty-INF (AF524866[GenBank] ), E-9 DM (AF524867[GenBank] ), E-11 Gregory (X80059[GenBank] ), E-11 Hun/90 (AY167103[GenBank] ), E-11 Kar/87 (AY167104[GenBank] ), E-11 Kust/86 (AY167105[GenBank] ), E-11 Mor/M/82 (AY167106[GenBank] ), E-12 Travis (X79047[GenBank] ), E-13 Del Carmen (AY302539[GenBank] ), E-14 Tow (AY302540[GenBank] ), E-15 Ch 96-51 (AY302541[GenBank] ), E-16 Harrington (AY302542[GenBank] ), E-17 CHHE-29 (AY302543[GenBank] ), E-18 Metcalf (AF317694[GenBank] ), E-19 Burke (AY302544[GenBank] ), E-19 K/542/81 (AY167107[GenBank] ), E-20 JV-1 (AY302546[GenBank] ), E-21 Farina (AY302547[GenBank] ), E-24 De Camp (AY302548[GenBank] ), E-25 JV-4 (AY302549[GenBank] ), E-26 Coronel (AY302550[GenBank] ), E-27 Bacon (AY302551[GenBank] ), E-29 JV-10 (AY302552[GenBank] ), E-30 Bastianni (AF311938[GenBank] ), E-30 14916net87 (DQ534205[GenBank] ), E-31 Caldwell (AY302554[GenBank] ), E-32 PR-10 (AY302555[GenBank] ), E-33 Toluca-3 (AY302556[GenBank] ), EV 69 Toluca-1 (AY302560[GenBank] ) and EV 73 CA55-1988 (AF241359[GenBank] ).

Virus-specific antisera.
E-11/D207- and CAV-9/Griggs-specific rabbit antisera were produced by hyperimmunizing rabbits with 3–4 doses of purified virus (20–30 µg per dose) in Freund's complete (the first dose) or incomplete adjuvants. Seven to ten days after the last booster, blood samples were drawn for serum. Rabbit antisera to strains E-11/MorM/82, E-11/Pah/89, E-11/Vlad/89, E-11/Kust/86 and E-11/Kar/87 were kindly provided by Dr G.A. Koroleva. More information on these strains can be found in Lukashev et al. (2002, 2003). E11-specific polyclonal antiserum used in plaque neutralization assay was purchased from Swedish Institute for Infectious Diseases Control, Solna, Sweden.

Peptide scanning.
Overlapping peptides spanning the capsid protein sequences of the E-11 isolate D207 were synthesized on polyethylene glycol derivatized cellulose membranes (Hartman Analytic) using a 12-amino-acid window and three-residue shift in a 384 spot format. Epitope mapping assay was performed basically as instructed by manufacturer (ABIMED and Genosys) and as described previously (Harkonen et al., 2002, 2003; Pulli et al., 1998). Briefly, the peptide-coupled membranes were incubated at 4 °C overnight with blocking buffer [Tris-buffered saline (TBS), pH 8.0], containing 0.05 % Tween-20 (Fluka), 1 % casein (Genosys), and 5 % w/v sucrose. All subsequent steps were performed at room temperature. Membranes were incubated for 2 h with virus-specific hyperimmune rabbit serum, diluted in blocking buffer, washed 5x5 min with washing buffer and incubated with horseradish peroxidase (HRP)-conjugated anti-rabbit immunoglobulins (Bio-Rad; 1 : 1500) for 30 min. Membranes were washed as above and incubated for 1 min with chemiluminescence reagent plus (NEN Life Science Products). Chemiluminescence was counted with a Victor scintillation counter (PerkinElmer) and verified by autoradiography. The membranes were regenerated with 8 M urea, 1 % SDS/0.1 % β-mercaptoethanol (3x30 min at 50 °C), 5x10 min (room temperature) in 50 % ethanol/40 % water/10 % acetic acid and 5x5 min with TBS 0.05 % Tween. The success of regeneration was tested with incubation of the membranes with conjugate.

Human pancreatic islets.
Human pancreatic islets were isolated and purified at the Uppsala University Hospital (coordinator Professor Olle Korsgren) as previously described (Johansson et al., 2003), with the consent of the ethics committee of Uppsala University. In Helsinki parallel aliquots of islets were infected with an apparent high multiplicity of isolate D207 or CAV-9 Griggs (Ylipaasto et al., 2005).

Cell viability.
Viability of islets infected with isolate D207 or CAV-9 were measured using the live/dead cell fluorescence assay with fluorescent probes (Molecular Probes). Islets harvested at one week after treatments were incubated with the labelling solution for 30 min at room temperature in the dark and analysed with a confocal microscope (Leica TCS NT).

Isolation and preliminary characterization of an aberrant CAV-9 strain from a diabetic child
An EV was isolated in human amnion (FL) cells from a stool specimen of a diabetic 12-year-old child at onset of T1D in Slovakia. After passaging in GMK cells the isolate was typed as CAV-9 by using well-characterized antiserum pools and monotypic antisera. Islet cell tropism of isolate D207 was studied in primary cultures of human islets and the islet cell destructive phenotype was found (not shown).

Molecular cloning and sequencing of the isolate; genetic identity E-11 rather than CAV-9
In order to characterize the D207 isolate at molecular level a full-length infectious clone was produced. Viral RNA extracted from plaque-purified virus-infected cells was converted into cDNA and used as a starting material for corresponding full-length PCR. Full-length PCR product was gel extracted and ligated into pGEM-T Easy vector. Full-length clone linearized with the NotI restriction enzyme was transcribed into RNA using T7 polymerase. Infectivity of the full-length RNA was documented by transfection experiments. Infectious clone was sequenced using the primer walking strategy.

The full-length genome comprised 7432 nt. The 5' non-coding region was 745 nt and the 3' non-coding region 106 nt. The single open reading frame was coding for a 2195 aa polyprotein. The comparison of capsid protein VP1 sequences between the isolate D207 and strains in GenBank revealed that the isolate D207 does not belong to CAV-9, but is E-11 (Table 1). Comparison of different regions of the D207 genome with the prototype strains E-11 Gregory and CAV-9 Griggs indicates that D207 is closer to E-11 Gregory in capsid regions. In non-structural proteins 3A and 3B, D207 is more similar to E-11 whereas in 2A, 2C, 3C and 3D and also in both 3' and 5' non-coding regions it is more similar to CAV-9 Griggs (Table 1). In order to analyse genetic relationships of isolate D207 with other E-11 strains, phylogenetic trees were constructed using different regions of the genome. All E-11 strains formed a monophyletic group in the capsid-encoding region (Fig. 1). Within this group, the closest relatives of the D207 isolate were E-11 strains that were isolated from infants with severe EV infections in 1986–1990. These strains were designated E-11/B group due to their marked serological difference from the prototype E-11 strain Gregory (Lukashev et al., 2002). Strains E-11/Kust/86 and E-11/Kar/87 were isolated from infants with uveitis, while strain E-11/Hun/90 was isolated during an outbreak of severe multisystem disease (MSD) of newborns in Hungary (el-Sageyer et al., 1998). We can therefore conclude that isolate D207 belongs phylogenetically to the E-11/B subtype. In the non-structural region, all E-11 strains did not cluster together (Fig. 1), but the relationship of D207 to the uveitis-causing strains E-11/Kust/86, E-11/Kar/87 and MSD-causing strain E-11/Hun/90 still held true. Likewise, in the 5' non-coding region the strains showed similarity of 90 % or more to D207.


Table 1. Comparison of E-11/D207 with EV-11 Gregory and CAV-9 Griggs



(43K):

Fig. 1. Phylogenetic trees of capsid region (a) and non-structural region (b) of selected EV genomes.

SimPlot analyses revealed only a few short motifs in the capsid-coding region of E-11/D207 that were closer to the prototype CAV-9 Griggs than to E-11 Gregory. The longest sequence found was VFCGSAMATGKFLLAY, derived from VP3. In the amino acid alignment, 15 sporadic positions could be identified, where E-11/D207 and E-11/B strains from uveitis and MSD patients had amino acids identical to CAV-9 Griggs and different from those of E-11/Gregory.

The D207 isolate of E-11 is neutralized with polyclonal CAV-9-specific antiserum, but also with E-11-specific antiserum
Neutralization of E-11 isolate (D207) was studied further by plaque-neutralization assay with polyclonal antisera to E-11 and CAV-9 (Hovi & Roivainen, 1993). In parallel with the original isolate (D207), the first passage of the same isolate and the virus strain produced from the infectious clone constructed in the study (Lipo-D207) were analysed. Prototype strains of CAV-9 and E-11 were used as positive controls. As shown in Table 2(a), the prototype strains were only neutralized with their own virus-specific antiserum, whereas all three parallel strains of the isolate D207 were neutralized with E-11-specific antiserum (reduction of infectivity about 3 logs) and with CAV-9-specific antiserum (reduction of infectivity about 2–3 logs).


Table 2. Neutralization of genotype 1B echo 11 viruses.


When non-neutralizable plaques were picked up from the cultures infected with the isolate D207 in the presence of CAV-9-specific antiserum, grown in GMK cells and reneutralized with either CAV-9- or E-11-specific antiserum, the results did not differ from those obtained with the original strain (Table 2b). The corresponding result was also seen in plaques isolated in the presence of E-11-specific antiserum. These results indicate that double neutralization with CAV-9- and E-11-specific antisera is a real property of the isolate D207.

Neutralization properties of isolate E-11/D207 are shared with uveitis-causing strains of E-11
As shown by phylogenetic analysis, the uveitis-causing strains of E-11/B subtype were the closest relatives of isolate D207. Next, it was studied whether the capability of the virus to be neutralized with CAV-9-specific antiserum goes together with the phylogenetic relationship. When two E-11 strains known to cause uveitis (Kust/86 and Kar/87) and one strain that was almost incapable of inducing uveitis in monkeys, E-11/Kh3/97, were tested for neutralization, we found that two of them were neutralized with CAV-9 antiserum whereas one was not (Table 2c). Interestingly, both neutralized virus strains were those uveitis-causing strains of E-11/B subtype.

When polyclonal rabbit antisera produced against six uveitis-causing E-11 strains were analysed for neutralization with D207 isolate, we found that the isolate was neutralized efficiently by all of them (Fig. 2). The infectivity of D207 was completely blocked by antisera raised against the uveitis-causing E-11 strains E-11/Kust/86, E-11/Kar/87 and E-11/Pah/89, and against MSD-causing strains E-11/Vlad/88 and E-11/Hun/90 (infectivity reduced by more than 6 logs). All these strains were previously shown to belong to E-11/B subtype (Lukashev et al., 2002, 2003). Meanwhile, the infectivity of isolate D207 was reduced by only 3 logs with the antiserum to E-11/Mor/M/82, which caused uveitis, but did not belong to E-11/B subtype. This same neutralization pattern was seen with other highly uveitic E-11 strains, E-11/Kar/87 and E-11/Kust/86. In contrast, neutralization profiles of the E-11 prototype strain Gregory and the less pathogenic strain E-11/Kh3/97 (Lukashev et al., 2003) were more restricted, since neither of them were properly neutralized with antisera to E-11/Pah/89 and E-11/Mor/M/82. Interestingly, all E-11/B strains and prototype strain Gregory studied were neutralized completely with a polyclonal rabbit antiserum to E-11/D207. Altogether, our results suggest that E-11/D207 shares antigenic properties with both E-11/B strains causing severe infant infections, and with CAV-9.



(18K):

Fig. 2. Neutralization of E-11 strains and CAV-9 with antisera produced against selected E-11 strains and CAV-9.

Identification of antigenic regions in the E-11 isolate
In order to identify antigenic regions of the isolate E-11/D207, a hyperimmune rabbit antiserum was produced against purified virus particles and then used in antigenic analyses carried out with the peptide scanning technique. In this method a set of partially overlapping peptides was synthesized on cellulose membranes according to the P1-coded amino acid sequences resembling the uncleaved capsid protein precursor polyprotein of isolate D207. Peptide membranes were incubated with the virus-specific rabbit hyperimmune serum and the bound antibodies were quantified by chemiluminescence. As shown in Fig. 3, the virus-induced antibody responses were targeted to highly restricted regions of E-11/D207 viral proteins. Most of these regions are located in protein domains known to be antigenic in other EV and/or to show sequence variation between and/or within serotypes (Fig. 3, Fig. 4a and 4b). The most reactive peptides corresponding to amino acid sequences ASNSANRQDFTQDPGKFTEPV, IEQSALLQGDVVEAIEGAVARVADTISSGP and TNITDKRDSITYIPDTVKPDVSNH were derived from the C-terminal half of capsid protein VP4, the junction of the capsid proteins VP3/VP1 and the C-terminal end of capsid protein VP1, respectively. In addition to these major regions, six other restricted regions of capsid proteins, VP1, VP2, VP3, VP4, were recognized by the antiserum studied (Fig. 3, Fig. 4a and 4b). No reactivity was seen against the N-terminal PALTAVETGHT sequence of VP1, which is known to be highly immunogenic in most other EV (Hovi & Roivainen, 1993). Other antisera raised against the uveitis-associated E-11 strains reacted, however, to variable extent with this peptide in a standard EIA format (not shown).



(23K):

Fig. 3. Peptide scanning results of isolate D207 with D207 and CAV-9 polyclonal antisera. Overlapping peptides of 12 aa covering the capsid protein sequences of E-11 isolate D207 were synthesized with three residues shift in 384 format and the membrane was incubated at room temperature for 2 h with polyclonal antisera to CAV-9 or E-11/D207. The peptide-bound antibodies were visualized by HRP–anti-rabbit conjugate and ECL reagent. The chemiluminescence of spots (cps) was determined with a scintillation counter. The numbers of peptides with their location in the capsid proteins are shown in the figure. Amino acid sequences of individual peptides are shown in Supplementary Table S2 (available in JGV Online).


(26K):

Fig. 4. Identification of antigenic peptides of E-11/D207. (a) Amino acid sequences of E-11 /D207, E-11/Gregory and CAV-9/Griggs (CAV9) in capsid protein regions where peptides derived from D207 sequence reacted with antiserum to E-11/D207 and not with antiserum to CAV-9 in peptide scanning (E-11 specific). (b) Amino acid sequences of E-11 /D207, E-11/Gregory and CAV-9/Griggs (CAV9) in capsid protein regions where peptides derived from the D207 sequence reacted with antisera both to E-11/D207 and to CAV-9 in peptide scanning. (c) Amino acid sequences of E-11/D207, E-11/Gregory and CAV-9/Griggs (CAV9) in capsid protein regions where peptides derived from D207 sequence reacted with antiserum to CAV-9 and not with antiserum to E-11/D207 in peptide scanning. Red label indicates positions where amino acid residues of E11/D207 and CAV9 were identical but differed from that of E11/Gregory. Protomeric positions of antigenic amino acid sequences are shown in right hand panels where a computer model of X-crystallographic analysis of the structure of E-11 was used as the template; colour codes: turquoise, VP1; violet, VP2; yellow, VP3, black, antigenic amino acid sequence.

Identification of E-11/D207 capsid protein motifs cross-reacting with CAV-9 antiserum
In order to identify regions of E-11/D207 capsid proteins capable of cross-reacting with CAV-9 antiserum, reactivity of the D207 peptide membrane was studied with the previously produced well-characterized hyperimmune rabbit antiserum to CAV-9 (Pulli et al., 1998). As shown in Fig. 3 and Fig. 4b, the CAV-9-induced antiserum recognized several of E-11 capsid protein-derived peptide sequences. The results also revealed that some peptides representing regions of capsid proteins of E-11/D207 were recognized in EIA, at least to some extent, by both CAV-9- and E-11/D207-specific hyperimmune antisera (Fig. 3, Fig. 4b). In amino acid alignment of the capsid protein sequences, some of these regions showed remarkable sequence difference between the two virus strains (Fig. 4b). The CAV-9-induced antiserum also reacted with several regions in the sequences that were not recognized by the E-11/D207-induced antiserum (Fig. 3, Fig. 4c). Several of these sequences showed partial sequence identity between the two virus strains at least to the same extent as those reacting with both antisera (Fig. 4b). Furthermore, some regions reacting with only the E-11/D207 antiserum did not show more sequence divergence than the two other categories (Fig. 4a). We have shown in this study that E-11 strain D207, initially serotyped as CAV-9, actually harbours double type specificity and shares this property with a previously described subgroup of E-11 strains associated with outbreaks of uveitis and multisystem disease of newborns. Phylogenetic analysis of these strains showed they were also the closest phylogenetic relatives of the D207 strain, suggesting common evolutionary history. No definite motifs within the capsid protein sequence could be identified, suggesting a simple recombination between E-11 and CAV-9 strains as a reason for the double antigenic reactivity, while a few distinct sequences binding the CAV-9 antiserum were revealed by peptide scanning.

The D207 strain was subjected to detailed studies firstly, because it was isolated from a diabetic patient and secondly, because it initially appeared to be an aberrantly behaving CAV-9 strain. Primary human islets in culture have been widely used in studies where diabetogenic determinants of EV have been of interest and human β-cells have been shown to be highly sensitive to different EV serotypes. However, the consequences of virus replication on β-cell survival and β-cell specific function have been strongly dependent on the virus strain (Roivainen et al., 2000, 2002). For example, the prototype strain of CAV-9 caused only subtle morphological changes sometimes associated with impaired functional properties of insulin-producing β-cells (Roivainen et al., 2000). When the D207 isolate, initially identified as CAV-9, was studied for β-cell tropism in primary human islets, a rapid cytolysis coinciding with severe functional damage of the surviving cells was evident. This finding prompted us to clone the isolate for full-length genome sequencing and molecular characterization. Surprisingly, based on the whole-genome sequence, the isolate turned out to be E-11. Phylogenetic analyses of E-11/D207 revealed that it was closely related in the capsid-encoding region to a specific subgroup of E-11 strains, previously designated E-11/B, known to cause severe infant infections, uveitis and MSD (Lukashev et al., 2003). This suggests that the capsid-encoding regions of D207 strain and the uveitis associated E-11/B strains have a common evolutionary history and have diverged from the rest of E-11 strains long ago. The potential genetic counterpart of the uveitis association of E-11/B strains has not been identified, and with the current knowledge we cannot say anything about putative pathogenic role of the D207 in the diabetes of the patient from whom the virus was isolated.

In contrast with the capsid-coding region, the non-structural region of isolate D207 was significantly different from the uveitis- and MSD-causing E-11/B strains. This suggests that the ancestors of the isolate acquired the non-structural part of the genome by recombination with some other HEV-B virus, as suggested previously (Chevaliez et al., 2004; Lukashev et al., 2004). It is possible that a somewhat closer relationship of isolate D207 to uveitis-causing strains in this part of the genome is explained by an overall elevated similarity of most modern HEV-B strains in the non-structural genome region (Lukashev et al., 2003).

Virus strains neutralized by two evidently monotypic EV antisera are extremely rare. In diagnostic laboratories carrying out EV serotyping by neutralization assay, a result suggesting double reactivity is primarily interpreted as a technical error. Careful retyping of the strain usually clarifies the situation. Primary serotyping of the D207 strain did not suggest double reactivity, which might be due to relative potencies of the E-11 and CAV-9 antibodies in the intersecting pools used. Double reactivity was revealed only in more detailed studies started after the surprising result of sequence-based identification. By neutralization experiments with polyclonal antisera raised against CAV-9 and E-11, respectively, it was demonstrated that neutralization of E-11/D207 with both antisera is a real characteristic of this virus strain. Further experiments on a collection of E-11 strains known to cause uveitis to a variable extent confirmed the idea that genetically related highly virulent strains, E-11/B isolates Kar/87, Kust/86 and Hun/90, are also neutralized with both antisera. While low degree cross-reactions between certain EV serotypes, when assayed with monotypic hyperimmune animal antisera, are known to exist even in neutralization assays, we are not aware of previous reports of this strong reaction, except in cases such as E-1 and 8, CAVs 11 and 13, and CAVs 15 and 18, which are now pairwise considered single serotypes, respectively. Our results therefore suggest that the serotype evolutionary space is not infinite and changes in the virus capsid can lead to apparent convergence of virus serological properties.

One could speculate that an E-11/CAV-9 recombination with the joining point within the capsid coding region could have resulted in the observed hybrid reactivity. However, neither visual nor computer-assisted SimPlot analysis of the capsid protein sequences gave support to this view. This is also in agreement with the observation that the antiserum raised against D207 strain did not neutralize CAV-9. Only sporadic amino acids distributed throughout the four capsid proteins showed identity between D207, most of the uveitis-associated strains and CAV-9 while differing from the E-11 prototype strain Gregory. On the other hand, an antiserum to CAV-9 was able to recognize distinct peptides synthesized according to the sequence of E-11/D207. Some of the reacting regions coincided with those reacting with an antiserum against the D207 strain. The amino acid sequences of some of these regions differed remarkably between the two virus strains and the above sporadic shared amino acids did not by any means concentrate in these regions. The three-dimensional atomic model of a protomer, based on the X-ray crystallographic analysis of E-11 (Stuart et al., 2002), revealed that at least some of the regions recognized by CAV-9 are located on the outer surface of the virion, suggesting that they could be candidates for neutralization epitopes specifically recognized by CAV-9-induced antiserum. Interestingly, the CAV-9-specific antiserum, but not the D207-specific antiserum, recognized peptides covering the sequence EILNYYAHWSGSVKLTFVFCGSAMATGKFLLAY from the capsid protein VP3. This region in E-11/D207 includes the 13 aa sequence which was found in Simplot analyses to be different from E-11 Gregory, but similar with that of CAV-9.

It is generally accepted that most of the known neutralizing antigenic sites in EV are conformational, while at least some of them can also be detected with peptide scanning reflecting binding of antibodies to linear sequences (Roivainen et al., 1991). The latter method may, in addition, detect linear capsid protein sequences capable of binding serum antibodies not relevant to virus neutralization. It is also known that properties of homologous animal hyperimmune sera may vary depending on the immunization procedure and the immunized animal. However, in this case the aberrant result seems to be a true property of the E-11 strains, as independent preparations of CAV-9 antisera gave a similar result (not shown). The D207 strain and several strains of E-11/B subtype isolated geographically in relatively distant locations shared this double serotype specificity and also showed monophyletic origin in most genomic regions, suggesting that the acquirement of additional CAV-9 specificity has occurred for a specific E-11 lineage only once in the past.

In conclusion, we have shown in this paper that an EV strain isolated from a diabetic child belongs to genetic subcluster B of E-11, but is also neutralized with monotypic antisera to CAV-9. The dual serological specificity turned out to be a common property among the strains of this genetic subcluster, since other genetically closely related virus strains studied were also neutralized by both E-11- and CAV-9-induced polyclonal antisera. Simplot and peptide scanning analyses carried out did not reveal a simple explanation for this dual specificity. Epitopes responsible for this feature remain unidentified.

The study was supported by grants from the Academy of Finland, the Sigrid Juselius Foundation, the Juvenile Diabetes Research Foundation (USA), the Finnish Diabetes Research Foundation, the Finnish Cultural Foundation and Jalmari and Rauha Ahokas Foundation. We thank Dr A. Petrovicova for providing us with the stool sample of the diabetic patient and Dr G. A. Koroleva for providing E-11 strains and antisera.

References

Al-Hello, H., Davydova, B., Smura, T., Kaialainen, S., Ylipaasto, P., Saario, E., Hovi, T., Rieder, E. & Roivainen, M. (2005). Phenotypic and genetic changes in coxsackievirus B5 following repeated passage in mouse pancreas in vivo. J Med Virol 75, 566–574.[CrossRef][Medline]

Andreoletti, L., Hober, D., Hober-Vandenberghe, C., Belaich, S., Vantyghem, M.-C., Lefebvre, J. & Wattre, P. (1997). Detection of coxsackie B virus RNA sequences in whole blood samples from adult patients at the onset of type I diabetes mellitus. J Med Virol 52, 121–127.[CrossRef][Medline]

Chevaliez, S., Szendroi, A., Caro, V., Balanant, J., Guillot, S., Berencsi, G. & Delpeyroux, F. (2004). Molecular comparison of echovirus 11 strains circulating in Europe during an epidemic of multisystem hemorrhagic disease of infants indicates that evolution generally occurs by recombination. Virology 325, 56–70.[CrossRef][Medline]

Clements, G. B., Galbraith, D. N. & Taylor, K. W. (1995). Coxsackie B virus infection and onset of childhood diabetes. Lancet 346, 221–223.[CrossRef][Medline]

el-Sageyer, M. M., Szendroi, A., Hutter, E., Uj, M., Szucs, G., Mezey, I., Toth, I., Katai, A., Kapiller, Z., Pall, G. & other authors (1998). Characterisation of an echovirus type 11' (prime) epidemic strain causing haemorrhagic syndrome in newborn babies in Hungary. Acta Virol 42, 157–166.[Medline]

Harkonen, T., Lankinen, H., Davydova, B., Hovi, T. & Roivainen, M. (2002). Enterovirus infection can induce immune responses that cross-react with β-cell autoantigen tyrosine phosphatase IA-2/IAR. J Med Virol 66, 340–350.[CrossRef][Medline]

Harkonen, T., Paananen, A., Lankinen, H., Hovi, T., Vaarala, O. & Roivainen, M. (2003). Enterovirus infection may induce humoral immune response reacting with islet cell autoantigens in humans. J Med Virol 69, 426–440.[CrossRef][Medline]

Hovi, T. & Roivainen, M. (1993). Peptide antisera targeted to a conserved sequence in poliovirus capsid VP1 cross-react widely with members of the genus Enterovirus. J Clin Microbiol 31, 1083–1087.[Abstract/Free Full Text]

Hyoty, H., Hiltunen, M., Knip, M., Laakkonen, M., Vahasalo, P., Karjalainen, J., Koskela, P., Roivainen, M., Leinikki, P. & other authors (1995). A prospective study of the role of coxsackie B and other enterovirus infections in the pathogenesis of IDDM. Childhood Diabetes in Finland (DiMe) Study Group. Diabetes 44, 652–657.[Abstract]

Jartti, T., Lehtinen, P., Vuorinen, T., Koskenvuo, M. & Ruuskanen, O. (2004). Persistence of rhinovirus and enterovirus RNA after acute respiratory illness in children. J Med Virol 72, 695–699.[CrossRef][Medline]

Johansson, U., Olsson, A., Gabrielsson, S., Nilsson, B. & Korsgren, O. (2003). Inflammatory mediators expressed in human islets of Langerhans: implications for islet transplantation. Biochem Biophys Res Commun 308, 474–479.[CrossRef][Medline]

Kang, Y., Chatterjee, N. K., Nodwell, M. J. & Yoon, J. W. (1994). Complete nucleotide sequence of a strain of coxsackie B4 virus of human origin that induces diabetes in mice and its comparison with nondiabetogenic coxsackie B4 JBV strain. J Med Virol 44, 353–361.[Medline]

Lole, K. S., Bollinger, R. C., Paranjape, R. S., Gadkari, D., Kulkarni, S. S., Novak, N. G., Ingersoll, R., Sheppard, H. W. & Ray, S. C. (1999). Full-length human immunodeficiency virus type 1 genomes from subtype C-infected seroconverters in India, with evidence of intersubtype recombination. J Virol 73, 152–160.[Abstract/Free Full Text]

Lukashev, A. N., Lashkevich, V. A., Koroleva, G. A. & Karganova, G. G. (2002). Phylogenetic and serological characterization of echovirus 11 and echovirus 19 strains causing uveitis. Arch Virol 147, 131–142.[CrossRef][Medline]

Lukashev, A. N., Lashkevich, V. A., Koroleva, G. A., Ilonen, J., Karganova, G. G., Reznik, V. I. & Hinkkanen, A. E. (2003). Molecular epidemiology of enteroviruses causing uveitis and multisystem hemorrhagic disease of infants. Virology 307, 45–53.[CrossRef][Medline]

Lukashev, A. N., Lashkevich, V. A., Koroleva, G. A., Ilonen, J. & Hinkkanen, A. E. (2004). Recombination in uveitis-causing enterovirus strains. J Gen Virol 85, 463–470.[Abstract/Free Full Text]

Oberste, M. S., Maher, K., Kilpatrick, D. R., Flemister, M. R., Brown, B. A. & Pallansch, M. A. (1999). Typing of human enteroviruses by partial sequencing of VP1. J Clin Microbiol 37, 1288–1293.[Abstract/Free Full Text]

Paananen, A., Ylipaasto, P., Rieder, E., Hovi, T., Galama, J. & Roivainen, M. (2003). Molecular and biological analysis of echovirus 9 strain isolated from a diabetic child. J Med Virol 69, 529–537.[CrossRef][Medline]

Perriere, G. & Gouy, M. (1996). WWW-query: an on-line retrieval system for biological sequence banks. Biochimie 78, 364–369.[Medline]

Pulli, T., Lankinen, H., Roivainen, M. & Hyypia, T. (1998). Antigenic sites of coxsackievirus A9. Virology 240, 202–212.[CrossRef][Medline]

Reunanen, A., Roivainen, M., Kleemola, M., Saikku, P., Leinonen, M., Hovi, T., Knekt, P., Leino, A. & Aromaa, A. (2002). Enterovirus, mycoplasma and other infections as predictors for myocardial infarction. J Intern Med 252, 421–429.[CrossRef][Medline]

Reunanen, A., Roivainen, M. & Kleemola, M. (2005). Increased titer of antibodies to Mycoplasma pneumoniae may be associated with coronary heart disease. Atherosclerosis 180, 209–210.[Medline]

Roivainen, M. (1999). Enteroviruses and myocardial infarction. Am Heart J 138, S479–S483.[CrossRef][Medline]

Roivainen, M., Narvanen, A., Korkolainen, M., Huhtala, M. L. & Hovi, T. (1991). Antigenic regions of poliovirus type 3/Sabin capsid proteins recognized by human sera in the peptide scanning technique. Virology 180, 99–107.[CrossRef][Medline]

Roivainen, M., Alfthan, G., Jousilahti, P., Kimpimaki, M., Hovi, T. & Tuomilehto, J. (1998a). Enterovirus infections as a possible risk factor for myocardial infarction. Circulation 98, 2534–2537.[Abstract/Free Full Text]

Roivainen, M., Knip, M., Hyoty, H., Kulmala, P., Hiltunen, M., Vahasalo, P., Hovi, T. & Akerblom, H. K. (1998b). Several different enterovirus serotypes can be associated with prediabetic autoimmune episodes and onset of overt IDDM. Childhood Diabetes in Finland (DiMe) Study Group. J Med Virol 56, 74–78.[CrossRef][Medline]

Roivainen, M., Rasilainen, S., Ylipaasto, P., Nissinen, R., Ustinov, J., Bouwens, L., Eizirik, D. L., Hovi, T. & Otonkoski, T. (2000). Mechanisms of coxsackievirus-induced damage to human pancreatic beta- cells. J Clin Endocrinol Metab 85, 432–440.[Abstract/Free Full Text]

Roivainen, M., Ylipaasto, P., Savolainen, C., Galama, J., Hovi, T. & Otonkoski, T. (2002). Functional impairment and killing of human beta cells by enteroviruses: the capacity is shared by a wide range of serotypes, but the extent is a characteristic of individual virus strains. Diabetologia 45, 693–702.[CrossRef][Medline]

Stuart, A. D., McKee, T., Williams, P., Harley, C., Shen, S., Stuart, D., Brown, T. & Lea, S. (2002). Determination of the structure of a decay accelerating factor-binding clinical isolate of echovirus 11 allows mapping of mutants with altered receptor requirements for infection. J Virol 76, 7694–7704.[Abstract/Free Full Text]

Thompson, J. D., Gibson, T. J., Plewniak, F., Jeanmougin, F. & Higgins, D. G. (1997). The CLUSTAL_X windows interface: flexible strategies for multiple sequence alignment aided by quality analysis tools. Nucleic Acids Res 25, 4876–4882.[Abstract/Free Full Text]

Titchener, P. A., Jenkins, O., Szopa, T. M., Taylor, K. W. & Almond, J. W. (1994). Complete nucleotide sequence of a beta-cell tropic variant of coxsackievirus B4. J Med Virol 42, 369–373.[Medline]

Williams, C. H., Oikarinen, S., Tauriainen, S., Salminen, K., Hyoty, H. & Stanway, G. (2006). Molecular analysis of an echovirus 3 strain isolated from an individual concurrently with appearance of islet cell and IA-2 autoantibodies. J Clin Microbiol 44, 441–448.[Abstract/Free Full Text]

Ylipaasto, P., Kutlu, B., Rasilainen, S., Rasschaert, J., Salmela, K., Teerijoki, H., Korsgren, O., Lahesmaa, R., Hovi, T. & other authors (2005). Global profiling of coxsackievirus- and cytokine-induced gene expression in human pancreatic islets. Diabetologia 48, 1510–1522.[CrossRef][Medline]

Received 24 September 2007; accepted 25 March 2008.